SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3ZCV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3ZCV0
Domain Number 1 Region: 14-70
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000157
Family F-box domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3ZCV0
Sequence length 99
Comment (tr|K3ZCV0|K3ZCV0_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL17355.1, ECO:0000313|EnsemblPlants:Si024380m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_024380mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MDADDAPHVANGNYGVLPADVLYNIFLCLPANPLCHLRLVCHSWWSLTPDPLFARAHSSR
HPHVAALHCNLQALHVVDLHDKIVVKRLHLGQPGFFLGT
Download sequence
Identical sequences K3ZCV0
Si024380m|PACid:19698845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]