SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3ZHQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3ZHQ8
Domain Number 1 Region: 362-606
Classification Level Classification E-value
Superfamily RNI-like 4.91e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.032
Further Details:      
 
Domain Number 2 Region: 143-379
Classification Level Classification E-value
Superfamily RNI-like 3.14e-39
Family Cyclin A/CDK2-associated p19, Skp2 0.025
Further Details:      
 
Domain Number 3 Region: 10-48
Classification Level Classification E-value
Superfamily F-box domain 0.0000445
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3ZHQ8
Sequence length 628
Comment (tr|K3ZHQ8|K3ZHQ8_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQK95592.1, ECO:0000313|EnsemblPlants:Si026110m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_026110mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MRGADLINPALPDEILDDVIRRVGAGPGGGKRDLDACALVCRRWRRLERASRRSARLAAS
GEHADEVLRLVAERFPALADVSVDERLTSAGVVGAVPRSRRPRQAPTSSPFRRRRRLPLA
SNSVHIAPFPLDQPAGDDGSEHSCLTDVGLTHLSRGCRGLEKLSLIWCSAISSTGLVRIA
ENCKNLTSLDLQACYIGDPGLIAVGEGCKQLKNLNLRFVEGTTDEGLIGLVKGCGQSLVS
LAVATCVWLTDASLRAVGSHCPNLEILSVESDRVQDEGVISISKGCRQLKTLKLQCISAG
DEALDSIGLFCSLLESLSLNNFERFTDRSLSSIAKGCKNLTDLVLNDCQLLTDSSLEFVA
RSCKKLARLKVNGCQNMETAALEHIGRWCPGLLELSLIFCPRIQNSAFLEIGRGCSLLRT
LYLVDCSSISDSALCHIAQGCKNLTELSIRRGYEIGDQALISIAENCKSLKELTLQFCER
VSDTGMSAIAENCSLHKLNLCGCTLITDSGLTAIARGCPELVYLDISVLRIIGDIALAEI
GEGCPMLKEIAFSHCPEVTDVGLNHLVRGCLQLESCQMVYCRQITSAGVATIISGCSRLK
KLLVEESKVSERTRRRAGPVLSFLCTGL
Download sequence
Identical sequences K3ZHQ8
Si026110m|PACid:19708046 XP_004979833.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]