SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3ZL08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3ZL08
Domain Number 1 Region: 123-421
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000667
Family Cyclin A/CDK2-associated p19, Skp2 0.061
Further Details:      
 
Weak hits

Sequence:  K3ZL08
Domain Number - Region: 46-94
Classification Level Classification E-value
Superfamily F-box domain 0.00265
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3ZL08
Sequence length 491
Comment (tr|K3ZL08|K3ZL08_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQK93260.1, ECO:0000313|EnsemblPlants:Si027264m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_027264mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MEEIQTSSPCSWQPRRLRRRPRANTTDETNGGAPCTAHQPLQANEAASQGTVPELPEDAL
QHIHSLMTMRDAACVSRRFLFFWRRYPNLAFNQEYISGYRGKYVFSKAQYVLENHSGVGV
KMLKLNLSTCSKKDIDINLLDGWLRAFIKPGITELAFLHLASCDFHPTEGPRLLGCSRSL
STVCLHNVRITGDEVGFFLSSCFALERLDLSKCSMITSLKIPRVLHKLRIVQLHMCQVLQ
TVEINALNLSPFNYNGCPLSSFSLGDSLETKELLMHVVGMPDLIQYVGCNVPSIAPNLEM
LMLSTVNEKLKAPAIFDKFQHLKHLVICLGKRGEFFKGYDFFSLAHFLDACVALETFTLR
IQIGCRWYDMQSRVAIMPFRHGGLRSLRKATITGFCSSKSLVELTCHILRSAASSLQFIL
LDTSRGYDWKHSLTDRCRTMGTMDLQDSERALFNIRQYVEPKVPPGVELKVLGPCSRCHS
IDAKAMEEATS
Download sequence
Identical sequences K3ZL08
Si027264m|PACid:19708340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]