SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3ZT76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3ZT76
Domain Number 1 Region: 38-89
Classification Level Classification E-value
Superfamily F-box domain 0.000000000183
Family F-box domain 0.0071
Further Details:      
 
Weak hits

Sequence:  K3ZT76
Domain Number - Region: 196-413
Classification Level Classification E-value
Superfamily RNI-like 0.000392
Family Cyclin A/CDK2-associated p19, Skp2 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K3ZT76
Sequence length 453
Comment (tr|K3ZT76|K3ZT76_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL22412.1, ECO:0000313|EnsemblPlants:Si029806m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_029806mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MEPTSSPAQGWAPLTADDCILPKKRKTCCSVQQPAQNNDRISALPDDILIKVLSLMTVME
AAVTACLSTRWRHLWGNVDHLILDKHTFKMQVPENSNNNENPDLWNQEATKFVSKVNEVL
HHHNGNGIKKIEVKFPLSSSHSADLDHWVEFAATSGSKTLNLILSGYHGMGATRHAEKYS
FPLKHFVDLGVVLNIMSSCCALRRFGLQRCHRLINMRFAHAKLVDLVVLGCKGLISISIH
AEKLKYFSYKGHKVDIEYECTPVLHKLRAFFVKNNECPLDFLGHLPNLTALTLQFPTCLQ
VSRVLQHSKRFAGLKNIVLCLLTSWKTSIRSVAYLLKDAPLVETLVLQVYGNLQPQSKLK
IIWPKKCILGRLHAIRIRGFSGEPELMRLLSFLLKRSPWLKKLDIDTHPHKYSGFNKWKR
KKSEDATRCYYARGVALTHLPLEIPSTVTLRVR
Download sequence
Identical sequences K3ZT76
Si029806m|PACid:19712373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]