SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3ZUD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3ZUD6
Domain Number 1 Region: 9-81
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000196
Family F-box domain 0.0092
Further Details:      
 
Domain Number 2 Region: 119-287
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000000405
Family Galactose oxidase, central domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K3ZUD6
Sequence length 372
Comment (tr|K3ZUD6|K3ZUD6_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL22351.1, ECO:0000313|EnsemblPlants:Si030217m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_030217mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MAPPSTTTTELIDDVTAEILLLLPPDEPEHLFRAALVCKPWLRILCDPAFLRRYRAYHGA
PPLLGFIHRFAGDLVSRLASTTSVPAFTHPGSDGRGARAFDCRHGRVLMSQDEISVYNFL
VWNPVSGDRRRCVPVPDIDYWLYSAAVLCAADGCDHLDCHDGPFRLVLAGRDTRSNLICA
CVYSSETCTWSTPVSLDNSRGFHVRSRPGALVNDEIYFTFSRDDAILKYDWGNNWLSMVK
TPVPRSRYYGFAAVMTMVDGSLGLGRVEDSSLYLWSRKVNSEGDAEWILCRVIELETVMP
IANLSPYGANVVAFADGVDVIFLGTNAGLFTIELKSGRVRMFGESWLHLSILPYMSFYTP
DRGTLLSLARTL
Download sequence
Identical sequences K3ZUD6
Si030217m|PACid:19712648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]