SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K3ZZB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K3ZZB6
Domain Number 1 Region: 23-87
Classification Level Classification E-value
Superfamily F-box domain 0.00000000213
Family F-box domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K3ZZB6
Sequence length 153
Comment (tr|K3ZZB6|K3ZZB6_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL26715.1, ECO:0000313|EnsemblPlants:Si031948m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_031948mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MELRSGRRRLGTQPPRGAGRNCRPRRGRSRDGGAVDRISELSDDMLIQILARLRCPRAAA
RTSVLSRRWRDRGLWKHLPELSFRGIAYTLSKPPSPSLVPAGAFASLLRTTVSLDPVELS
IAIRWVNPMPIQVPSFSRATSITLNVTYLHLAR
Download sequence
Identical sequences K3ZZB6
Si031948m|PACid:19709822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]