SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4A3B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4A3B1
Domain Number 1 Region: 25-74
Classification Level Classification E-value
Superfamily F-box domain 0.000000000157
Family F-box domain 0.0089
Further Details:      
 
Domain Number 2 Region: 177-296
Classification Level Classification E-value
Superfamily RNI-like 0.0000235
Family Cyclin A/CDK2-associated p19, Skp2 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4A3B1
Sequence length 479
Comment (tr|K4A3B1|K4A3B1_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQL22244.1, ECO:0000313|EnsemblPlants:Si033364m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_033364mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MELSGGDSEGAPKRAKLSSGDACGGEDCLSALPDDVLVLILLRLDTTVAARTSVLSRRWR
RVWALLPKLCFPLAPEPHRFRDTLDTHEVPLRDLLVGAGGATPESLAIWLPAAARRVSGD
LTLLTFDPGKDAGEEEGEAAQRGAFELPCFEKATSISLILGFHGLAIAMPPTGVFARLTG
IYLSCVRFHGPCALGDAMSSPRCPCLQRLTVDDSRGLGDLTINSVSLLQMELRNLRGLWQ
VTVVAPALTELTVIYCFRNDDTQPVANISAPQLVSLDFYLVYGQDGLSHNHSCLTLLQRF
EAIETLFLTLAYMREIENYQYLMEDMMVLPDITFLCLDVIANGHAFGASSFHALRLCTGI
RRLTLLFAAPTGLEAQTVCPSGCICHQPAEWETEGLSLNHLEEVEIRHLRGSEHEVAFVK
RLFSWATVLKQIKVTFYYSIPEIKAKELYQMFWSFSRPGMRMTFYIYRKFSKVVYVPED
Download sequence
Identical sequences K4A3B1
Si033364m|PACid:19711224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]