SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4AJ32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4AJ32
Domain Number 1 Region: 24-77
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000249
Family F-box domain 0.0071
Further Details:      
 
Weak hits

Sequence:  K4AJ32
Domain Number - Region: 114-190,222-257
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00301
Family Soluble quinoprotein glucose dehydrogenase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4AJ32
Sequence length 394
Comment (tr|K4AJ32|K4AJ32_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQK89571.1, ECO:0000313|EnsemblPlants:Si038896m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_038896mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MSEDGSGRQGASSAAVPASPLEDDNLLSLILHRLPAVPSSLLRASLVCKGWRSLVSDPRF
LRDFRTYHKNSPLLGFFSGDLLGNVEFTTMLGSSDCIPASRFSLCLRPGSRFLCSHHGRI
LILDQEEQQFLVWDPVTGELGNIAFPPAFNGKMLFIIDGGIVCAATDQGHVHGACHSDPF
RLVFLGEDRERILACAYSSETRAWGNLFSIMRPPYFVRYNSPKCPSTLSRNSISLLLFGD
KAVILEFDWGKGNLALIDVPSDAYDFDAFIGGMCQFMIAHVDSGGLCFYLLSAFSVHVWK
RVCNSDGIATWMLEDTIELRNLLSLKPTMHLTILGLDEDNKVILKLTDSVVFMVSLESMQ
FKTLSTQLPFYSFSFHPFKSFYTPAVKPCCLIQS
Download sequence
Identical sequences K4AJ32
Si038896m|PACid:19683376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]