SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4ALM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K4ALM2
Domain Number - Region: 21-55
Classification Level Classification E-value
Superfamily F-box domain 0.049
Family F-box domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4ALM2
Sequence length 404
Comment (tr|K4ALM2|K4ALM2_SETIT) Uncharacterized protein {ECO:0000313|EMBL:KQK86855.1, ECO:0000313|EnsemblPlants:Si039803m} KW=Complete proteome; Reference proteome OX=4555 OS=Setaria italica (Foxtail millet) (Panicum italicum). GN=SETIT_039803mg OC=PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria.
Sequence
MYSNPFAAATKRRRLPPMQGDQHLPLELLLEVVARSDDAASIARCAAASRPLRRAMLGAG
FRPVTRVGLIAAVRAGYDPARLLGVSYASADRGDDEHDIVRASWRLRFDTGQLRSLELVS
SRGGLLVLWRHEAEAEPELRVCNTFTGNVACLPYMDGEVGKWGNPGIYRPTLLTVADAGR
SFELLAMDGCLRTCIFSSSVIRSINGSGKWGAIRLVALPPEHDCWCFVNQSAHTSPAIIG
RIVHWICRSTQRAAGVFILAVHADSAEATAIEPPPQGYLGGSSSTGSCCTLAATPEGNLS
MFVPEAEVISMWTLSTEGWSRDAVICKHGIGKQVMPGVDVNGMICWCVGFGERSRTVIFW
MEKVGLIELNLGTMKANVLPWGGEHGTSRIAGVCFHEIDVASLL
Download sequence
Identical sequences K4ALM2
Si039803m|PACid:19685680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]