SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4B5H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4B5H3
Domain Number 1 Region: 154-267
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000116
Family B3 DNA binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4B5H3
Sequence length 273
Comment (tr|K4B5H3|K4B5H3_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc02g032270.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101266081 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MEDDDGGGLKEESCITDFECVDVEKDEAFRKNPFMCEHSVDHYYYLLPRAKRSRIFRRKN
PPPTVMPSQSMSQKKDPKIRISLKRKTIETVDEDLSVEGKKTETLFDEKHSKWENREEKR
RKIYKPIIDPPVLPDELKEMISGMGVQISQVKLVIQKVLYDTDLSYKHMRMSIPVNQVVR
KDFLTPQQKMVLETRDIESNKKSKIQFNLIEPSLEQTKIHLTKWDMSNSSSYVLLNDWMQ
VVKRNKLKSGMVVQLWSFHQHLVPWLALVSVRQ
Download sequence
Identical sequences K4B5H3
Solyc02g032270.1.1 XP_004231680.1.44838 Sopim02g032270.0.1 Solyc02g032270.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]