SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4B6H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K4B6H6
Domain Number - Region: 22-78
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.002
Family B3 DNA binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4B6H6
Sequence length 86
Comment (tr|K4B6H6|K4B6H6_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc02g062880.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN= OC=Solaneae; Solanum; Lycopersicon.
Sequence
MYQDEDEDAYEDEEDEDKHLSQSYFECTIRQYCLSSDLMWIPKDFAFANGFIKGNKKYRL
IIIDETKTKLWNLMLKFCNILSLCCG
Download sequence
Identical sequences K4B6H6
Solyc02g062880.1.1 Sopim02g062880.0.1 Solyc02g062880.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]