SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4B6J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4B6J6
Domain Number 1 Region: 11-140,408-526
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 7.46e-76
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.001
Further Details:      
 
Domain Number 2 Region: 206-381
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.62e-48
Family Group II chaperonin (CCT, TRIC), apical domain 0.00016
Further Details:      
 
Domain Number 3 Region: 146-210,371-407
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 3.66e-23
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4B6J6
Sequence length 535
Comment (tr|K4B6J6|K4B6J6_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc02g063090.2.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101258617 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MSVKVLNPNAEVLNKSAALHMNINAAKGLQDVLKTNLGPKGTIKMLVGGAGDIKLTKDGN
TLLKEMQIQNPTAVMIARTAVAQDDTSGDGTTSTVLFIGELMKQSERCIDEGMHPRVLVD
GFEIAKRATLQFLEKFKTPVVMGNEPDKEILKMVARTTLRTKLYESLADQLTDIVANSVL
CIRKPDEAIDLFMVEIMHMRHKFDVDTRLVEGLVLDHGSRHPDMKRRAENCYILTANVSL
EYEKSEVNAGFFYSNAEQREAMVAAERRSVDERVQKIIDLKNQVCAGNDKNFVVINQKGI
DPPSLDQLARAGIIALRRAKRRNMERLVLACGGEAVNSVDDLTPECLGWAGLVYEHVLGE
EKYTFVENVKNPHSCTILIKGPNDHTIAQIKDAVRDGLRAVKNTIEDEAVILGAGAFEVA
ARQHLINEVKKTVKGRAQLGVEAFANALLVIPKTLAENSGLDTQDVIIALTGEHDKGNVV
GLNQRTGEPVDPQMEGIFDNYSVKRQIVNSGPVIASQLLLVDEVIRAGRNMRKPT
Download sequence
Identical sequences K4B6J6
XP_004233497.1.44838 Solyc02g063090.2.1 Sopim02g063090.0.1 Solyc02g063090.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]