SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K4BA48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4BA48
Domain Number 1 Region: 189-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-16
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 6-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000184
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K4BA48
Sequence length 293
Comment (tr|K4BA48|K4BA48_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc02g081780.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN= OC=Solaneae; Solanum; Lycopersicon.
Sequence
MLMDSDNTPAFCKLLQFGEVFISKMMPSCFIKENKKMLTKACLLKTDEAGMLWEAKIVRE
KSNNYFICEGEWPQFVVHHQLKQGDVLLFFLVEKSVFHVHPYTRKCRRNIRDEKKKLFYQ
QLSSTSSSSSSEEVEIGPDRKVNSTDEESVDEDDSPCYKNPKQENLSDDGGGGNGSKKFR
GGSSMMNFKTDHPYYEMVVKRSHKTFMTIPKRFAKMTGIFSMKNMKVVNEEKKGYWRVEI
VDMSGTIRITKGWAAFRTYNKIVCGDSCRFKLIKPNTLQVQKVPKHASLKSYH
Download sequence
Identical sequences K4BA48
Solyc02g081780.1.1 Sopim02g081780.0.1 Solyc02g081780.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]