SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4BMA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4BMA5
Domain Number 1 Region: 120-234
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000318
Family B3 DNA binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4BMA5
Sequence length 246
Comment (tr|K4BMA5|K4BMA5_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc03g119560.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN= OC=Solaneae; Solanum; Lycopersicon.
Sequence
MNITMEDIPINPNWTRLDILAVVCERVLEEEEEIVKETAMHEAESREKLMRVENPNRPID
DQVKTRIKTRKREYDPEDKRRRIIGKKRKKSETGKILPMPQIVKDRINQLEKGVKEVKFI
IEKEIFKTDCGEHQNRLSIPITQVVEKFLTDEEEKYLCMPSNGNRINFKKVRVIDPSLDI
YELELRRWKMTESAIYALNGKWTKMRVRNKIKKGNTIQIWAVRMDDDELIIVIMKLSPDE
KTKVIN
Download sequence
Identical sequences K4BMA5
Solyc03g119560.1.1 Solyc03g119560.1.1 Sopim03g119560.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]