SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4CA37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4CA37
Domain Number 1 Region: 30-106
Classification Level Classification E-value
Superfamily TSP9-like 6.67e-22
Family TSP9-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4CA37
Sequence length 106
Comment (tr|K4CA37|K4CA37_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc06g076790.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101259757 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MASLNMFVSPIATVTAQQHRSRVYTAATASKSSGGSTEEKSLLDFILGALQKQDQLLETD
PLLKKVEDKSVSTTSSGRKNSVAVPPKKNSNGGGFAGFGGLFNKKD
Download sequence
Identical sequences K4CA37
Solyc06g076790.1.1 Solyc06g076790.1.1 XP_004241176.1.44838 Sopim06g076790.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]