SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4CCG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4CCG2
Domain Number 1 Region: 13-73
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000165
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K4CCG2
Sequence length 96
Comment (tr|K4CCG2|K4CCG2_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc07g017470.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN= OC=Solaneae; Solanum; Lycopersicon.
Sequence
MSKELPFDGAPAVLSYGGKKWNLIYGGAKTKYKFSTGWKNFADDNNLKEGDGLVFELSEC
NSDKIEFKIQILREDFPAELVPDVEGMNTNNPIIID
Download sequence
Identical sequences K4CCG2
Solyc07g017470.1.1 Solyc07g017470.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]