SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4CIA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4CIA8
Domain Number 1 Region: 296-390
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-19
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 427-523
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-18
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 3 Region: 4-95
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-17
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 4 Region: 151-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000647
Family B3 DNA binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4CIA8
Sequence length 544
Comment (tr|K4CIA8|K4CIA8_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc08g006190.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN= OC=Solaneae; Solanum; Lycopersicon.
Sequence
MKFAPKKPHFFKPILPNFKHGIKIPVAFCKHLKGCNQEHAILRKSDKKWQVKVNGRLLDE
GWAIFAKENDLQLGDCLIFRHEGDFEFEVSIFGSNHFERVYEQTPKGGEEINHTCNKIIS
QAKTTEKTKLNVKSNEIIPEVEAAENMPLDRPPFIFTVTPYCLTRGHVQLPVQFARDNSL
MNRRCTITIRDEQRSLTFALYSSGARTYIKGQWREFCIANCLKKGDQIMLAIVDNGMNPV
LRFYGNSDVIIFNLKLDLRTNASLQLEVKKPNLDAEEVSSRKEVATVPASTSANANAQFV
SIIHPYAIIRALFYLPLSFARPNGLMRRCKMILKDEKQRSWSVQLEEVGPRFAITKGWRQ
FREANDVQVGDTYKFELIHNGTTPVAYFHRTRANASVQPEEKKPNLDARRVSARSNEADV
PASTCDNANTQFVSTINPHCINSPFIYLPSAFAKSNSLVNRRCKMILRDEKQRSWSVVLA
PMGHHTAITKGWRQFREANGFQVGDTYKFELIDNGTIPIAYFHCEYIYFPSFHYVPPCYA
TLFQ
Download sequence
Identical sequences K4CIA8
Sopim08g006190.0.1 Solyc08g006190.1.1 Solyc08g006190.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]