SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4D1U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4D1U5
Domain Number 1 Region: 319-421
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-19
Family B3 DNA binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  K4D1U5
Domain Number - Region: 5-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0135
Family Erythroid transcription factor GATA-1 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4D1U5
Sequence length 879
Comment (tr|K4D1U5|K4D1U5_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc10g075030.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN= OC=Solaneae; Solanum; Lycopersicon.
Sequence
MESKICMNGLCGTTSSIEWKKGWPLRSGEFATLCDKCGNAYEQLLFCDLFHSEDTGWREC
ISCGKRLHCGCIASSSLLELLDSGGINCISCVRSCQQHATPNHEKPKAFGTSISNSVGET
ASTSLGSQINGSEPNKREGSDSIDPALLLLHQNDNTNSPIGQIKMEETFHPAGESGSTFS
SNLFQASAEFSKNAKLDSYNGYKGVVEIHGSTVQTNLSIALSAPSPNSKLFPTTLDEGDL
NKTISSLQQGSRSRNLLPKPPKSASALGPEMNAGIISQIRVARPPVEGRIKNQLLPRYWP
RITDQELQQISGDSNSTIIPLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGLPLR
IQDVKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRMDPEGKLLMGFR
KASTVKITQENRLSAIPKNVFSTEPTSFSAMPENLPLMSGYSGLLQSFKGSRESSVNLSS
KHFNSGDFSWYLTEKNGGRNADGAFSPSMPVSERKRSRNIGSKSKRLLIDAHDALELKLS
WEELQDMLRPPLSVQPTTVTIEDQEFEEYEQPPVLGKRSIFTVRLSGEQEQWAQCDNCFK
WRKLPADYLLPPHWTCQDNISDHSRSSCSIPDDLTPRELENLFKMDKDFKKQRSAAGQRI
TQAHDSSDLDSQANGISIAGDLGEPGPASVATTTKHPRHRPGCSCIVCIQPPSGKGKHNP
TCTCNVCMTVKRRFKTLMMRKKKRQSEREAELGQRNQLMWSSKEETEVDSFSRPVKPEVD
PSEKERSGSETLARGHSSYQLQKLPEITCLPLETYLRQNGLTSLVSEQQGSSGSQGLPQD
TRESDLRVQEDLCLASTAQEQEKDVPKENSEPDQTGKDQ
Download sequence
Identical sequences K4D1U5
Solyc10g075030.1.1 Sopim10g075030.0.1 Solyc10g075030.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]