SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K4MAI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K4MAI7
Domain Number 1 Region: 1-215
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.6e-56
Family Phosphate binding protein-like 0.00016
Further Details:      
 
Domain Number 2 Region: 218-289
Classification Level Classification E-value
Superfamily GlnB-like 6.67e-21
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K4MAI7
Sequence length 290
Comment (tr|K4MAI7|K4MAI7_9EURY) ATP phosphoribosyltransferase {ECO:0000256|HAMAP-Rule:MF_00079} KW=Complete proteome; Reference proteome OX=1094980 OS=Methanolobus psychrophilus R15. GN=Mpsy_0336 OC=Methanosarcinaceae; Methanolobus.
Sequence
MISIALPKGSLEEQTYLLFKQADLEIKKTDRDYNPTIKDPRIGKIKILRPQEIPGYVSDG
YFDLGISGLDWVRESNADIMEVADLPYSKQGAGNVKIVIAVPKDSDIESAKDVKPGSRVA
SEYPNLTKKFFEDRGVPVDVHFSYGATEAKVPDLMDVVVDLTETGSTLRKNGLKIVDIIM
ESSSKLIANKKSWEDPVKRQEIEEIKTLLLSVIEARGKVLLDMNVPADKLDAVIESLPSM
KRPTVSQLYKSDYYAVETVVNKSEVNLLIPKLKALGAEDILEMDISKIVY
Download sequence
Identical sequences K4MAI7
WP_015052271.1.66729 gi|410669544|ref|YP_006921915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]