SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7AAG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7AAG0
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7AAG0
Sequence length 159
Comment (tr|K7AAG0|K7AAG0_PANTR) Mitochondrial ribosomal protein L43 {ECO:0000313|EMBL:JAA14831.1} OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0004121 OC=Catarrhini; Hominidae; Pan.
Sequence
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQVQAQ
Download sequence
Identical sequences K7AAG0
NP_115488.2.87134 NP_115488.2.92137 XP_005270288.1.92137 XP_006718098.1.92137 XP_016774629.1.37143 XP_018890126.1.27298 hsi002025749.1 gi|28872734|ref|NP_115488.2| ENSPTRP00000055035 ENSP00000315948 ENSP00000359256 ENSPTRP00000055035 ENSP00000315948 ENSP00000359256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]