SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7AQ56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7AQ56
Domain Number 1 Region: 59-211
Classification Level Classification E-value
Superfamily PH domain-like 5.6e-23
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7AQ56
Sequence length 329
Comment (tr|K7AQ56|K7AQ56_PANTR) Family with sequence similarity 43, member B {ECO:0000313|EMBL:JAA09998.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0039360 OC=Catarrhini; Hominidae; Pan.
Sequence
MLPWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRR
QKVELNKEDPTYTVWYLGNAVTLHAKGDGCTDDAVGKIWARCGPGGGTKMKLTLGPHGIR
MQPCERSAAGGSGGRRPAHAYLLPRITYCTADGRHPRVFAWVYRHQARHKAVVLRCHAVL
LARAHKARALARLLRQTALAAFSDFKRLQRQSDARHVRQQHLRAGGAAASVPRAPLRRLL
NAKCAYRPPPSERSRGAPRLSSIQEEDEEEEEDDAEEQEGGVPQRERPEVLSLARELRTC
SLRGAPAPPPPAQPRRWKAGPRERAGQAR
Download sequence
Identical sequences K7AQ56 Q6ZT52
ENSP00000331397 ENSP00000331397 NP_997217.1.87134 NP_997217.1.92137 XP_513169.3.37143 ENSP00000331397 9606.ENSP00000331397 gi|46409306|ref|NP_997217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]