SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7DA60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7DA60
Domain Number 1 Region: 35-254,300-410
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-55
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7DA60
Sequence length 412
Comment (tr|K7DA60|K7DA60_PANTR) Parvin, alpha {ECO:0000313|EMBL:JAA29967.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=PARVA OC=Catarrhini; Hominidae; Pan.
Sequence
MLGIIPLPFGKPQPQSRRRPLRPPSASSASRPARGSLRRAMATSPQKSPSVPKSPTPKSP
PSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEV
RTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEK
LNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQY
FRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDK
LNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSF
EQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE
Download sequence
Identical sequences G3RFD1 J3KNQ4 K7DA60
ENSP00000334008 NP_060692.2.87134 NP_060692.2.92137 XP_003818222.1.60992 XP_004050764.2.27298 XP_009458230.2.37143 ENSP00000447198 gi|315583337|ref|NP_060692.2| ENSP00000334008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]