SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7E2F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E2F0
Domain Number 1 Region: 45-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000988
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7E2F0
Sequence length 142
Comment (tr|K7E2F0|K7E2F0_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000039951} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MQRRDFAKGDNVYILLTVDDISHLRSNKSSHIPLKMPTLQRDSGADLCENFHCENDGVCV
IYKDKAECRCRSLKDLWFVGEKCQIQMFASLQSTVEALFLVTSFAVAVVASLLSFYYGKK
KYGRRKNARTSNMTIENQNTPS
Download sequence
Identical sequences K7E2F0
ENSMODP00000039951 ENSMODP00000039951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]