SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7E2T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K7E2T2
Domain Number - Region: 79-173
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000314
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7E2T2
Sequence length 193
Comment (tr|K7E2T2|K7E2T2_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000040083} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
XXXXXXRGPGAGREGWGRPCIHATSCPPTQALPDSSTGQEALENPAALPRELSDSFLPRT
LSLRNSISKILSEAGSEPLEEEWKSISEIASTCNSILEALSQEGQQVPESGDPREALKAE
PEPGPGSLSEKVSHLEMMLKKLQEDLQKEKADKAALQEEVRSLRHNNRRLQAESQSAAAR
LLRASQQLGAPGP
Download sequence
Identical sequences K7E2T2
ENSMODP00000040083 ENSMODP00000040083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]