SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7E384 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K7E384
Domain Number - Region: 242-276
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0968
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7E384
Sequence length 308
Comment (tr|K7E384|K7E384_MONDO) Coiled-coil domain containing 192 {ECO:0000313|Ensembl:ENSMODP00000040235} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CCDC192 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MGLCHSRKSGSVTPQSDKVMSDTTDKRSIMSNNEGSVMDMPQRSRMTTEALESGEEAPTW
TCLQDLKMCLQEAEDKVKTLSEQLAVSEGTKTKLLEQVSWLEEQLETADIKEVRGEPYEE
IMHAKNQRIEKLQAEVKASQEQLAAHKLKHKRKMKKLQTDLATAKQEAAITVLELNEKIK
TLYEGKPSPRGCLRISFRLLKCKISTIRTCILATRIPEENSLEESCGGLPPVEEGDRRMS
LIMELSTQVSLQTEKINQLEEVLEEKERKIQQLEAERETPMFQMGSPPECLPEAPSASND
RTSAVDID
Download sequence
Identical sequences K7E384
ENSMODP00000040235 XP_007497872.1.35504 ENSMODP00000040235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]