SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7E4T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E4T5
Domain Number 1 Region: 827-875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000237
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 2 Region: 345-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 3 Region: 873-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 4 Region: 934-984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 5 Region: 982-1033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 6 Region: 779-820
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 7 Region: 281-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 8 Region: 433-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000223
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 9 Region: 468-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 10 Region: 520-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 1139-1187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 12 Region: 1091-1134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 13 Region: 1034-1088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.0026
Further Details:      
 
Weak hits

Sequence:  K7E4T5
Domain Number - Region: 1622-1773
Classification Level Classification E-value
Superfamily Tropomyosin 0.0425
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7E4T5
Sequence length 1785
Comment (tr|K7E4T5|K7E4T5_MONDO) Laminin subunit beta 2 {ECO:0000313|Ensembl:ENSMODP00000040787} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LAMB2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MRLILGHQGWGLGGPELWLLLLLIVLAKAVVQNPDLPSAGCSRGSCYPATGDLLVGRADR
LTASSTCGLRGPEPYCIVSHLQDEKKCFLCDSRHPFSARYPQSHRIQNVVTSFAPQRRSA
WWQSENGVSSVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSSDFGRTWRVYRYFSYDC
GSDFPGIPLAPPHRVDDVVCESRYSEIEPSTEGEVIYRVLDPAIPITDPYSSRIQDLLKI
TNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCARAPGAPSHA
EGMVHGACVCKHNTRGLNCESCQDFYHDLPWRPAEDGHSHACKKCECHQHSRSCHFDMAV
FLASGNTSGGVCDDCQHHTAGMHCEICRPFYYRDPTRDLRDPAVCRPCDCDPSGARDGGL
CDPHDDPMLGLVSGQCRCKEHVVGPRCQRCRDGYFGLSTTNPQGCQRCQCDPRGTVPGGP
PCDSNSGDCFCKRLVTGKHCDRCLTDHWGLSHDLLGCRPCDCDVGGALEPRCAEDSGQCR
CRRHMFGRRCDQVQPGYFLPFLDHLTLEAEKARGQALDVVERTARPGMTISWTGVGFVRL
REGQILEFLVDSVSQAMDYELLLRYEPQVPEQWAEVTLTVQRPGPISHSSPCGTTVAEDD
HFRGMLQPGARYVVLPYPVCLEPGVSYTLLLELTRAGGDARPGAPTPTLLLDSLVLLPRW
SSLEMFSSGDAGALERRATFERYRCHEEGLMPAKSPPSEACAPLLRSLAALLHNGALACQ
CDPQGSLSSECQPHGGQCPCKANVAGRRCDHCAPGTFGFGPSGCRACQCSPDGSFSSLCH
EASGQCPCRPGAFGLRCDRCQPGQWGFPSCRPCHCNGHSDECDPRTGACQRCRDHTAGDN
CERCTAGFYGNPVLASGGHCRPCPCPEGPGGQRHFATSCHQDRHSQQVVCHCQPGYTGPR
CEECAPGHFGDPQRPGGRCQPCECSNNIDPMDPEACDRRSGQCLRCLHHSEGPRCAHCRP
GYYGQAAHQSCRRCTCNFLGTERSQCPSQDKCRCDPGSGQCPCLPNIQGQSCDRCAPNFW
NLASGRGCQPCSCHPSHATSPSCNEFTGQCHCRAGFGGRTCTECQENHWGDPGLQCRACD
CDPRGIETPQCHHATGHCVCRPGVAGVRCDQCARGFSGVFPACQPCHACFGDWDRIVQGL
ASRTRALEQRSRELHQLGALGAFEKNFRLLGEKLGTVQGIVNARNATAAATLQLMATTED
LRHDIEEATGQLTRLEGELTDAQDENFNANHALSGLERDGRALNLTLRQLGQHLDVLKHS
NFLGAYDSIRQSHAQSSEAEYHANRSALAIPSPVSDSAATRRRAESLMGSQRDNFDRRNV
ANRRALGELAARANTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQRRCGGLNCQG
AAATADNALGRARHTQEELRRTLGDADGLVGKVAEARLQAGMARQRAQAALEKANETRGR
VERANQELRELIQNVKDFLSQEGADPGSIEAVATHVLELSIPASPAQIHHLAGEIAERVR
SLGDVDTILQRTAGDVRQAEQLLQDAQRARNGILSMQRHRDGRWRVLCEKWQEGPFGSGG
IMDNKAGKVREKTAGAEQDLTMAAERTQRLDAQLDALKLKRAGNSLEATRAEETANSAQG
RAQEAEKLLKGQLGDRYQTVRELADRKAQGVLQAKERAERLRDEARGLLQDAQDKLRRMY
ELEGTYEVNERALEDKAAQLDGLEAKMKGVLQSINQQIQIYNTCQ
Download sequence
Identical sequences K7E4T5
ENSMODP00000040787 ENSMODP00000040787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]