SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7E5E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7E5E7
Domain Number 1 Region: 7-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000442
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7E5E7
Sequence length 93
Comment (tr|K7E5E7|K7E5E7_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000040999} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEIVNSCEQNNGGCSHHCEHSTGGPRCSCNHGHRLDMDGKTCKDLDECESGQACCSQLCI
NYLGGYECDCKTGFQLSPDGCGCDGKYLGFVFK
Download sequence
Identical sequences K7E5E7
ENSMODP00000040999 ENSMODP00000040999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]