SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7EIK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EIK7
Domain Number 1 Region: 51-201,266-332,372-539
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.39e-47
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Weak hits

Sequence:  K7EIK7
Domain Number - Region: 569-614
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00733
Family WD40-repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7EIK7
Sequence length 773
Comment (tr|K7EIK7|K7EIK7_HUMAN) Echinoderm microtubule-associated protein-like 2 {ECO:0000313|Ensembl:ENSP00000464789} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=EML2 OC=Catarrhini; Hominidae; Homo.
Sequence
MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWV
YGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTI
ATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVD
ESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLS
KRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGL
CALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSI
LQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIEDP
ARSAGFHPSGSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFSPDGAYLAVGSH
DNLVYVYTVDQGGRKVSRLGKCSGHSSFITHLDWAQDSSCFVTNSGDYEILYWDPATCKQ
ITSADAVRNMEWATATCVLGFGVFGIWSEGADGTDINAVARSHDGKLLASADDFGKVHLF
SYPCCQPRVLGKWPSAAEAALSSGIRVLFRPLVASLGPAWKNVPRKFCWKSAGDSPRDPP
PRPQGHSQPSFPSSGPWETAVCKFYRQGRWREVRVFASWAPPCIPHSQWLWFPSSEPQFL
WELELSLETGNRLPPCPFCPRLAMASCPLRMVPWGRPILCGFLHSAHPSINCP
Download sequence
Identical sequences K7EIK7
ENSP00000464789 ENSP00000464789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]