SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7ELI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7ELI6
Domain Number 1 Region: 42-166
Classification Level Classification E-value
Superfamily FKBP-like 2.95e-39
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7ELI6
Sequence length 171
Comment (tr|K7ELI6|K7ELI6_HUMAN) Peptidylprolyl isomerase {ECO:0000256|PROSITE-ProRule:PRU00277} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FKBP10 OC=Catarrhini; Hominidae; Homo.
Sequence
MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQ
MGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVP
PHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMV
Download sequence
Identical sequences A0A2J8KG48 K7ELI6
ENSP00000466097 ENSP00000466097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]