SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7EN63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EN63
Domain Number 1 Region: 57-128
Classification Level Classification E-value
Superfamily POZ domain 2.88e-21
Family Tetramerization domain of potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7EN63
Sequence length 128
Comment (tr|K7EN63|K7EN63_HUMAN) BTB/POZ domain-containing protein KCTD15 {ECO:0000313|Ensembl:ENSP00000466804} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KCTD15 OC=Catarrhini; Hominidae; Homo.
Sequence
MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHI
DVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTS
KLLLPDDF
Download sequence
Identical sequences A0A2J8QGW7 A0A2J8RKZ0 K7EN63
ENSP00000466804 ENSP00000466804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]