SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7G2Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7G2Q8
Domain Number 1 Region: 1-352
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.27e-69
Family ADP-ribosylglycohydrolase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7G2Q8
Sequence length 361
Comment (tr|K7G2Q8|K7G2Q8_PELSI) ADP-ribosylhydrolase like 1 {ECO:0000313|Ensembl:ENSPSIP00000014569} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=ADPRHL1 OC=Pelodiscus.
Sequence
MEKFKAAILLAGVGDALGYRNFTRENSALGAKIQEELKEIGGLQNLVLSAEKWPVSDNTL
MHMATAEAVITDGQSPYLEDLYRELVKRYVDIIDRLPGRRPDPATIEGCSQLKPDNYLLA
WHTPFNEKGSGFGAATKAMCLGMKYWKPERLDTLIEVSIECGRMTHNHPTGFLGSFCTAL
FVSYAIQGKPLVQWGREMMKVVPMAEEYCKKTIRHMAEYQEHWFYFEAKWQFYLEEREIT
EENQNKPVFPDNYDAEEREKTYRRWSSEGRGGRRGHDAPMIAYDALLGCGGDWTELCNRA
MFHGGESAATGSIAGCLYGLLYGLNKVPKGLYQDLEHRERLEFLGETLYQRSTEENTMVY
M
Download sequence
Identical sequences K7G2Q8
ENSPSIP00000014569 ENSPSIP00000014569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]