SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7G3G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7G3G8
Domain Number 1 Region: 1111-1243,1305-1371
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.24e-37
Family Hemopexin-like domain 0.00091
Further Details:      
 
Domain Number 2 Region: 67-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000353
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 26-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000458
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7G3G8
Sequence length 1371
Comment (tr|K7G3G8|K7G3G8_PELSI) Proteoglycan 4 {ECO:0000313|Ensembl:ENSPSIP00000014829} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=PRG4 OC=Pelodiscus.
Sequence
MLWNIYYISLVLFSASLIQQVSSEDLSSCAGRCGEGYSREAACHCDYSCLHYMECCHDYK
KFCTEELSCKGRCFETFVRGRECDCDADCEKYGKCCPDYQKHCEEGHSSLTTKSSSTRTT
PLVTKTTAKRSSKNSKNKKPKKVVQSHEVMEEHSESEKQKSSSSSSSSLSTTTIRKTKAS
SKNPNENGQTKDIKNKNNRKAKDAMKGMSLTPVFPKARRWHKNMIIKITGFPIETPASQP
HKTTMTIKMNTTKILTPKTSMPPTTTTSTTKISALTNAAHVTKAKDKSTTSMKNATPTTT
KGATIAKKNTSIVTTTIDKETIAQTDKTVTAITESQTVTTAKPVTTAAAKDTVKTTAKKD
ATTIAKKDTTTVNDIIFSPDEKDVMSEKGTTTAAKNTVTRAPRTDTTTEIKDTVTTTGRK
DTTIVDKEKVTTKVLATTAKESIMTTAKLDTTTATKKTPTAAEVTTVATDLTNERETTTV
SDEVITLDEKDLTKKHTTTAARKTVTRAPRTSTTAEIKDTEPTARKRDITIVNKENMPTG
EKDKSTTDKKDTTVATETMMSTDERDTKDAKKTITAKRETATTTKTVTTGSAKDTVTSAT
KKDASTAGEEIRPSPYEKSLMPKKDTTAAYREIESSPNTATTAAARETVTRSPRTDTTID
TKDTLATTGKKDTSTVDKESVMTIDTKDTTTIAEVNIMTTGEKDTTGKDTTFAYREIVTT
KVTATAAKESIMTTAKLDTTTATKKTQTATKQTPTAAEITAVATDLTTADKEETEDNRQK
TTATKQTTEAKKELTAVIKGTTTEKASDDKEVTTTDKKETPESTVTKETLTVSEEVSTIA
KDSQERPVSPTQDGLGTTVTQIPPVKATAKPSIEPEKKANPAIEITATAPINLTTSNPKD
FMKTKVHFETTKETSTVTKRSVTTSISKGTTETKDISENAYTRDTATQKNTEQSPTDRLQ
TSKIIISPSLTQKPAANSVPSEQENHRDNSSPTPMDPMTVADSNFPGRNTENPKEPNQNP
TSPKQEDSIDSLAISFTTCIAPLKGTLNPNDTHNEKQENLSPGSIQKGRAEAANPHRRQS
VVCPRQPSEDYVPLIKIYTNYFDPGEQDDNNLCNGKPADGIVALPNGTLAVFRGHYYWLL
DSAKQPTVSPRKITEGWGIPSPIDTVFSRCNCDGKTFFFKGSQYWRFTNDVKDMGYPKQI
AKGFAGLNGKIVAVLSVAQHRNRPESVYFFKRGGNIQHYVYNQEPAKKCKKKVYVRYPAY
TPRAVIKRRRFERAIRPVMSHTIRLHHNPSGLLYLITGILHHEVKINSYWRGFPKVVRSA
ISIPNYQRPDGYDYYVFSKDQYYNVDVASRIARSVTAQTGQTVSNDWYKCP
Download sequence
Identical sequences K7G3G8
ENSPSIP00000014829 ENSPSIP00000014829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]