SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7IVM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7IVM2
Domain Number 1 Region: 691-825
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.36e-37
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1014-1109
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.82e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 22-103
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-20
Family PDZ domain 0.0076
Further Details:      
 
Domain Number 4 Region: 205-327
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000437
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 
Domain Number 5 Region: 960-1026
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000177
Family Ras-binding domain, RBD 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7IVM2
Sequence length 1378
Comment (tr|K7IVM2|K7IVM2_NASVI) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:NV13133-PA} KW=Complete proteome; Reference proteome OX=7425 OS=Nasonia vitripennis (Parasitic wasp). GN=LOC100117712 OC=Chalcidoidea; Pteromalidae; Pteromalinae; Nasonia.
Sequence
MQQQQQKHHQQPQHSRRKKKRVNYGSRTVELARGGKGFGFTISGQQPCILSCIVPGSPAE
LAGLRSGDYLVAVNGHGVGKAPHDDVVRLIGRSNGLLRLQIAEHYYSDSSEEDEASTKVR
SRPRYRSRSSNASGSSGLSATVHPQCRVAKVVRDLQSGAMFEASTTRISVPTNTHRWNMS
SPLPPPPPPSSRKRDSEKIVHRAVLGYLGTIDIPSHLHSVSMMSLVRKCIKRIKAEKRDP
TTVLLTIHVANIKLANTEGRVIAEYPSYRIVYCNSFSNEDKLHFGILTKSATANVGDVND
NHEKDNASNSCHVFKIYSKLTDHAIHANTCAAFGFGCTKASELNNACQEFPASCDGLVGA
IQTLYIADTAEGDANLFDNRRNHREAPSSPQPSNVSTSTAHSSNSDSGIGFKDECGCHSD
RNLNVEFPSYPHERSIVVSSLGRNVKDPSGSKLTVRAISDPRWSDFPRPYGYLDKSSDAE
QQVDSSPPRTDADYCSVEDYPEGRLLAHCQELKESRSRAESRRSAGGSSSNGGEGSIVSC
PAVPSGRFAHRHQCHQRASPAALAALARSPRYTSTLSVGTLHARSAARAARDISKSTGNF
FARMDVEVPDRLSPKVYTSGMKIQGYSMENLKTSPGSKSQTSDDHCNTTKSLPHSHTGKA
NDKVSRAWGSLQEIRKVAGCEHDDCMHGSTESCDKTTGFGVHTWAISFEKLLEDPKGLQT
FAKYLKKEISHENIYFWAACERYSDTEDLVARKRLAAQIYQRHLSNNAPEPVNVDSHAAG
KITPELLNSAPADLFAQAQKQVFNLMKFDSYPRFLRSDIYQKCLENGCDDIDTSPEDGDL
FLTSSPVKLKKSHSDAEDRCRKSILPWHRKNRSKSKDRGESEYNKTPSRGEKIYKSFSTI
QRDNEGNNNEEDSVSISSSRSSLASWDLALRQSFTKHSASSCEGQSNEKRETHVSKCAGL
CRVILPDGSTTVIPTSHSDSVRDVVTRLLDKRALRYSNYDVLMLATNEIINLKYPSSVLA
SQEVEVLPTKVIKVDLPSRRVISVVAHKGRTLKEVLKPLLNKYGFKLDLVTIWADGHPVS
VDIPAMNAPPRLALTSNNKEHIDDASLFKTPEVPRGQPTLDEITNKVFEELRVGKSESKY
DEDEGSCKSDGQKSEGSSILSSKFFSRDSTLHIKKKSKSKNSNTSEKSNSDCGNDESNRP
QPPLIAKWRNGVKLQLPSRFDGDDLYEGLKRAQRSRLEDQRGTEINFELPDFLKNKENGQ
KPSDDKKRRKSRIFSGHSDFSKFYDAEEEKSNLERCLDSSNSLDSTLVDADKTIVENGNQ
QLKSTKANNQDLSQLSPTKLSKPPPLPPKPKSLSNSLRNNVLPSRPFQRVTNYDKKTI
Download sequence
Identical sequences K7IVM2
7425.XP_001601876 XP_001601876.1.61660 gi|156547071|ref|XP_001601876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]