SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7K6R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7K6R4
Domain Number 1 Region: 146-392
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000000632
Family Cystathionine synthase-like 0.01
Further Details:      
 
Weak hits

Sequence:  K7K6R4
Domain Number - Region: 754-848,886-913
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00254
Family Cystathionine synthase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7K6R4
Sequence length 932
Comment (tr|K7K6R4|K7K6R4_SOYBN) Uncharacterized protein {ECO:0000313|EMBL:KRH70012.1, ECO:0000313|EnsemblPlants:KRH70012} KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GLYMA_02G062200 OC=Phaseoleae; Glycine; Soja.
Sequence
MHLSLWKPISQCAALIMDKSRRKEESNVEMRRNPSMLRKLQENKLREALEEASEDGSLSK
SQDIDQPDSAANQDDGLGRSRSLARLHAQREFLRATALAAERIFESEEEIPSLQEAFAKF
LTMYPKYQSSEKVDQLRSDEYSHLSPKVCLDYCGFGLFSFVQTIHYWESSTFSLSEITAN
LCNHALYGCAERGTVEYDIKARIMDYLNIPENEYGLVFTVSRGSAFKLLADSYPFHTNKK
LLTMFDHESQSIAWMAQSAREKGAKVHSAWFKWPTLKLCSTDLRKQISNKKKRKKDSATG
LFVFPVQSRVTGAKYSYQWMALAQQNNWHVLLDAGSLGPKDMDSLGLSLFRPDFIVTSFY
RVFGYDPTGFGCLLIKKSVMQSLQNQSGCTGSGMVKITPEFPMYLSDSVDGLDKFVGIED
DDEITGIGDKTTETRQGTQLPAFSGAFTSAQVRDVFETEMDQDSSERDGTSTIFEETESI
SVGEVIKSPVFSEDESSDNSFWIDLGQSPLGSDSAGQSNKHKTASPLPPFWFNGRRNQKQ
HSPKPTSKMYGSPMYDDREVNLGAHEDRRVLSFDAAVLMSQELDRVKEVPEEEHVEEVDH
YSRNGNGSDHLHVDEIVEEPGTSEAVNNGSWLNSTSLARHQSLENGSTSEICPDVKESAI
RRETEGEFRLLGRREGNRYGGDRFFGLEENEATSRGRRVSFNMEDNRKEYLSQTLEPGDI
SATSFDDEEVTSDGEYGDGQDWGRREPEIICRHIDHVNMLGLNKTTLRLRFLINWLVTSL
LQLKLAGSDGGEKANLVQIYGPKIKYERGAAVAFNVRDRSRGLINPEIVQKLAEKEGISL
GLGFLSHIQILDNSRQHRGAPNLEDTTLCRPMENGRRDGKGSFVRLEVVTASLGFLTNFE
DVYKLWAFVAKFLNPTFIREGGLPTVQEGSET
Download sequence
Identical sequences K7K6R4
Glyma02g06900.1|PACid:16247234 XP_003518083.1.40590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]