SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K7WX34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7WX34
Domain Number 1 Region: 16-200
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-65
Family Methylesterase CheB, C-terminal domain 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7WX34
Sequence length 206
Comment (tr|K7WX34|K7WX34_9NOST) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=46234 OS=Anabaena sp. 90. GN=ANA_C12456 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MGETIIFKINMPNLPNFDIVALAASAGGLTALIEVLSHLPADFKAAIVIVQHLDPRHPSL
MAEILSRRTPLTVKQAKEGDKLTPGTVYIAPPNNHLLVNSDGTASLSQSEMVHFLRPSAD
LLFESLAGSYKERAIAVVLTGTGSDGAMGVEAIQKMGGTVIAQDEKSAEFPGMPSAAIKT
GNVDFILPLAEISSALLTLVMPHPDL
Download sequence
Identical sequences K7WX34
gi|414077676|ref|YP_006996994.1| WP_015080337.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]