SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9IVY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9IVY7
Domain Number 1 Region: 615-870
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-55
Family YWTD domain 0.00000627
Further Details:      
 
Domain Number 2 Region: 3-263
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-55
Family YWTD domain 0.00000197
Further Details:      
 
Domain Number 3 Region: 314-544
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-52
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 4 Region: 917-1176
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-40
Family YWTD domain 0.000054
Further Details:      
 
Domain Number 5 Region: 1305-1340
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1267-1303
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1227-1265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 873-920
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000678
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 570-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 268-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000611
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1184-1236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000227
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9IVY7
Sequence length 1585
Comment (tr|K9IVY7|K9IVY7_DESRO) Putative low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:JAA53257.1} OX=9430 OS=Desmodus rotundus (Vampire bat). GN= OC=Phyllostomidae; Desmodontinae; Desmodus.
Sequence
ASPLLLFANRRDVRLVDAGGVKLESTVVVSGLEDAAAVDFQFSKGTVYWTDVSEEAIKQT
YLNRSGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDL
DQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKVIVDSDIYWPNGLTIDLEEQKLY
WADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEK
RKEILRALYSPMDIQVLSPERQPYFRTQCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQ
DDGKACKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWT
DDEVRAIRRAHLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR
KILVSEDLDEPRAIALHPGMGLMYWTDWGENPKIECANLDGQERRVLVNTSLGWPNGLAL
DLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIER
VHKVKASRDVIIDQLPDLMGLKAVNVAKFIGTNPCADRNGGCSHLCFFTPRTTKCGCPIG
LELLSDMKTCIVPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIY
WTDVSLKTISRAFLNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQ
FRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTTCMTLVDKVGRANDLT
IDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSEYIYWTDWNLHSIER
ADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHSNGQCGQLCLAVPGGHRCSCAS
HYTLDPSSRNCSPPSTFLLFSQKGAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKF
IYWVDGRQNIKRARDDGSQPSILTSPSPNQNSDRQPHDLSIDIYSRTLFWTCEATNTINV
HRLNGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTG
LIRPVALVVDNVLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTILGQHLYWT
DRQQQMIERVDKTTGDKRTRVQGRVAHLTGIHAVEDVSLEEFSAHPCARDNGGCSHICIA
KGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQS
DEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCEAVCLPNQFRCASGQCIL
IKQQCDSFPDCIDGSDELMCEITKPFLDEPPAHSSAIGPVIGIILSLFVMGGVYFVCQRV
VCQRYTGASGPFPHEYVSGTPHVPLNFIAPGTSQHGPFTGISCGKSMMSSVSLMGGRGGV
PLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSPNIPAPAGPYRP
YIIRGMVPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSC
PPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences K9IVY7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]