SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9PD75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PD75
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily L21p-like 9.55e-35
Family Ribosomal protein L21p 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PD75
Sequence length 132
Comment (tr|K9PD75|K9PD75_9CYAN) 50S ribosomal protein L21 {ECO:0000256|HAMAP-Rule:MF_01363, ECO:0000256|RuleBase:RU000562, ECO:0000256|SAAS:SAAS00352960} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_0634 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MTYAIIETGGKQIRVEAGRFYDIELLTAAPDEKVTIDAVLLVAHDGGVTIGQPRVAGATV
EGTVLRHLRGRKVLVYKMKPKKKTRKKRGHRQEITRLLINSINLNGTVLAAEEAAIAPTP
EVDDQAVETAAE
Download sequence
Identical sequences K9PD75
gi|427715963|ref|YP_007063957.1| WP_015126948.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]