SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9PEX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PEX4
Domain Number 1 Region: 21-371
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 3.4e-74
Family Iron-containing alcohol dehydrogenase 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PEX4
Sequence length 396
Comment (tr|K9PEX4|K9PEX4_9CYAN) Glycerol dehydrogenase {ECO:0000313|EMBL:AFY31496.1} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_1019 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MLNQFSTQTLSTQAPSSLFTLAIAPAKVICGVSVLQAAIAQIARLGSHPLIVAGDRTLKI
SQQHLQPLLEKQKLNVAAVSYGADCCETSLKSLNRAAKEHQADVIIGVGGGKALDTAKLI
AFQLQLPVVTIPTSAATCAAWSALSNVYSETGAFLYDVALSNCPDLLILDYELIATAPQS
TLVAGIGDAIAKWYEASVSSGNSQQTLTIAAVQQARVLRDILFQKSAVALKEPGSEVWRE
VVDATVLLAGVIGGLGGAQCRTVAAHAVHNGLTHICGHGSIHGDKVAYGILVQLRIEEMI
QGNQLAASSRQQLLKFYAEIGLPKKLDDLGLGNITLSELQTAAEIALSPNSDIHRLPFKV
ALEQLMAAMVSTTAPIDSRDATNRVSVMGMSDEVEE
Download sequence
Identical sequences K9PEX4
gi|427716336|ref|YP_007064330.1| WP_015127318.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]