SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9PHZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PHZ9
Domain Number 1 Region: 13-67
Classification Level Classification E-value
Superfamily Rubredoxin-like 6.06e-21
Family Rubredoxin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9PHZ9
Sequence length 114
Comment (tr|K9PHZ9|K9PHZ9_9CYAN) Rubredoxin {ECO:0000256|RuleBase:RU003820} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_1700 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MSEQSEQAVETQELDRYECRSCGYVYEPEKGDDKYEIPSGTPFAELPLTWRCPVCSAKKQ
AFSNIGPAGQASGFRENLSYGLGVNQLTPTQKNLLIFGALGLGFLFFLSLYGLQ
Download sequence
Identical sequences K9PHZ9
WP_015127974.1.42896 gi|427716997|ref|YP_007064991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]