SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9PM32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9PM32
Domain Number - Region: 388-419
Classification Level Classification E-value
Superfamily CinA-like 0.00392
Family CinA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9PM32
Sequence length 504
Comment (tr|K9PM32|K9PM32_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFY33602.1} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_3194 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MYRKQISQKASPSQQSTPKSQDIAPSRTYGSLSAVVQRVQQDPNSMSEDEGQQLESAIGT
RSMRKILAGKQTPWVPEFQGISQQLGAPIQAKRMDDVGISQAQPEHKTGLPDHLKTGIEN
LSGMVMDDVSVHYNSSKPSQLQALAYTQGTDIHVAPGQEKHLPHEAWHVVQQKQGRVKPT
MQLKDGIPVNDDQQMEREADVMGARAASQQVQQPPGHQYDSSVQMCVVQRVKLNAQLTKK
LKEWVTEAWGGDTDGLKEVIDWFAKATISQEDVKKIIDTHTLDDWWEWAQGVDPKDVDPE
DARKGSSTKGKAADVDPLAKVRKELRGRKLKPEDFTESELQAIDAGKAQGWDAAIQSVNQ
QRIERQENARLRAERITKYAPAKAAGDLVFPMGTLVRQVWDYSYAVAVSGNAGPNDTLSG
LFTDVEILAAVALWNHRGNIVPLAPPAAEAVTNFHVPDGGTGIFIQDKSTRLVNPDPNRG
RQADFICHWGAVTINVHVDATPQH
Download sequence
Identical sequences K9PM32
gi|427718442|ref|YP_007066436.1| WP_015129411.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]