SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9PN82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PN82
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.42e-42
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000000578
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9PN82
Sequence length 160
Comment (tr|K9PN82|K9PN82_9CYAN) 17 kDa polypeptide {ECO:0000256|HAMAP-Rule:MF_01344} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_3600 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MATLKKPDLSDPSLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPA
LTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFLENVNKF
QNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Download sequence
Identical sequences K9PN82
WP_015129799.1.42896 gi|427718832|ref|YP_007066826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]