SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9PPM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PPM2
Domain Number 1 Region: 51-134
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000785
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Weak hits

Sequence:  K9PPM2
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00167
Family Rubredoxin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9PPM2
Sequence length 137
Comment (tr|K9PPM2|K9PPM2_9CYAN) Tetratricopeptide TPR_2 repeat-containing protein {ECO:0000313|EMBL:AFY35345.1} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_4995 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MKCPVCGAVYRPTKGSRETGKDEELVSISTSSPSPTCRRCKADLSDLFHIHDHAIWYHRQ
ALHLLSQKLYPEAATYNNQALVLYYSNADFHTLAGKLSALQGEWREAILSWQQALKFDPQ
NAIASNCLQMIELMTRN
Download sequence
Identical sequences K9PPM2
gi|427720185|ref|YP_007068179.1| WP_015131138.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]