SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9PQK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PQK5
Domain Number 1 Region: 4-174
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.32e-40
Family Phosphoglucomutase, first 3 domains 0.00094
Further Details:      
 
Domain Number 2 Region: 257-386
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.14e-27
Family Phosphoglucomutase, first 3 domains 0.0013
Further Details:      
 
Domain Number 3 Region: 161-271
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.49e-22
Family Phosphoglucomutase, first 3 domains 0.0019
Further Details:      
 
Domain Number 4 Region: 389-476
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 2.88e-22
Family Phosphoglucomutase, C-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PQK5
Sequence length 478
Comment (tr|K9PQK5|K9PQK5_9CYAN) Phosphoglucosamine mutase {ECO:0000313|EMBL:AFY35710.1} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_5375 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MPVVVNPIKFGTDGWRGVIGDEFTFERLALVAPIAAKVLYDTYFSTVGSRTIIVGYDRRF
MAEDFARVVADSVTAIGFDVLLSDSYAPTPAFSWAAKQLNALGALVITASHNPGNYLGLK
VKGAFGGSVPPEVTKEIEALFTIGLPPVATRGKLEYFNPWPSYTQALEGKVDIRKIQDAL
ASGKVTVFADVMHGAAAGGLSRLLGEQVREINSERDPLFGGGAPEPLPKYISRLFEVIKT
HREANTTGLAVGLVFDGDCDRIAAVDSEANFLSSQILIPILIDHLTLRRGFSGEIVKTVS
GSDLIPRVAALHNLSVFETPVGYKYIADRMLVAEVLLGGEESGGIGYGSHIPERDALLSA
LYVLEAIVESGLDLGEYYHQLQAQADFNSAYDRIDLPLANMEVRSRLLTQLQTQPLTEIA
GLAVINTQTIDGYKFRLADNSWLMIRFSGTEPVLRLYCEAPTLDQVHQTLAWAKQWAE
Download sequence
Identical sequences K9PQK5
WP_015131501.1.42896 gi|427720550|ref|YP_007068544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]