SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9PRF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PRF0
Domain Number 1 Region: 15-245
Classification Level Classification E-value
Superfamily Folate-binding domain 8.95e-58
Family Aminomethyltransferase folate-binding domain 0.00099
Further Details:      
 
Weak hits

Sequence:  K9PRF0
Domain Number - Region: 262-325
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00278
Family Aminomethyltransferase beta-barrel domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PRF0
Sequence length 326
Comment (tr|K9PRF0|K9PRF0_9CYAN) Folate-binding protein YgfZ {ECO:0000313|EMBL:AFY35985.1} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_5662 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MSTSAIDSQDAAVIQAASEGVAVCDRSHWGRIRVSDDDRLRFLHNQSTNDFQSLKPGQGC
DTVMVTSTARTIDLVTAFVLDDAVLLLVSPNRREFLFQWLDRYIFFADKVQLTDVTDETA
TFSLIGPGSDAIVTKLGAGAIIGQPYGNHLLVDGVRVAVGSGLASPGYTLILPATDKEKL
WSQILALGAVELSDRTWDMLRILQGRPAPESELTDDYNPLEVGLWQTISFNKGCYIGQET
IARLNTYKGVKQYLWGIHLIAPAEVGEVITVGDEKVGKLTSYTETADGYFGLGYIRTKAG
GVGLKVKVGETEGEVVDIPFVSHDYP
Download sequence
Identical sequences K9PRF0
gi|427720825|ref|YP_007068819.1| WP_015131775.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]