SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9Q1B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Q1B2
Domain Number 1 Region: 303-387
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000188
Family Pollen allergen PHL P 1 N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9Q1B2
Sequence length 404
Comment (tr|K9Q1B2|K9Q1B2_9CYAN) Probable endolytic peptidoglycan transglycosylase RlpA {ECO:0000256|HAMAP-Rule:MF_02071} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_2665 OC=Leptolyngbya.
Sequence
MRLSKLTGFLSGLGVSALVTATEFTPMVAIAEASQPKHHTRIGKQPNVDFVATLQPLTQT
KNSVSQAEDSTVLAAAELMSQRQSLAQNPLCQLVSETAETPLAIAEAKVAAPTPSKFSNF
VSSFVQKFLRVIGLDHLMRTKPIKKSPVAVVSKTIQVNEKPSQTASNQQSSARFVSDRPQ
TTRPSLAQDYELWVKGSLIATVRSQEKADLLAQRLERLVETTNFNATAITPKLHQEQPAI
AMGDQILFVIDESITREDIKNYEILAIRWANNLRLAFGVPALDLITAQTQMYQVEETGQS
LEGLASWYGPYFHGRLTANGEIYDQYAFTAAHPSMPLDTYLKITNLDNEKSVIIRLNDRG
PYIPPRSLDLSLGAARCLNSVETGVIPYKATIMERRPTLATEAI
Download sequence
Identical sequences K9Q1B2
WP_015134690.1.56710 gi|427724493|ref|YP_007071770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]