SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9Q4D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Q4D3
Domain Number 1 Region: 17-219
Classification Level Classification E-value
Superfamily PP2C-like 0.000000000000458
Family PP2C-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9Q4D3
Sequence length 225
Comment (tr|K9Q4D3|K9Q4D3_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFY40223.1} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_4094 OC=Leptolyngbya.
Sequence
MDGFEWAAGSVIGKEHRRVNKNNQDAIAIKSATDYAIGIVADGCGSKAHSEVGAWLAVEL
LAEAIATHLPQPLTKQKIEEFGQNLLQNFPALPNFQNYYLFTLLGFVVTEEQSVIFGCGD
GIYAINDEIKQISYEDNAPPYLIYPETKLEIYAEISTEDLNSLFIGTDGIEEWIQQKELS
EFWQSDKYFKNPDQIRRTLAIAQKKESLSKDDTTLITLRHQLSVD
Download sequence
Identical sequences K9Q4D3
gi|427725780|ref|YP_007073057.1| WP_015135943.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]