SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9QE01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9QE01
Domain Number 1 Region: 9-246
Classification Level Classification E-value
Superfamily SAICAR synthase-like 5.89e-79
Family SAICAR synthase 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9QE01
Sequence length 253
Comment (tr|K9QE01|K9QE01_9NOSO) SAICAR synthetase {ECO:0000256|HAMAP-Rule:MF_00137} KW=Complete proteome; Reference proteome OX=317936 OS=Nostoc sp. PCC 7107. GN=Nos7107_3005 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MLKSLPPTMSVHSKLYEGKAKILYTTDNPEVLLADFKDDATAFNAQKRGSILDKGRINCS
ISSQLFKKLEANGIRTHFIDSPAPNQMRVKAVKILPLEVVIRNIAAGSLSQQTGLPVGTV
LKQPLVEFYYKNDQLGDPLLTSDRLLLLELATAEQVDVIKNLALQINEFLRRFWQQCGIT
LVDFKLEFGLDSQQQILLADEISPDTCRLWDTAETDPNRRVMDKDRFRRDLGNVEDAYQE
VLQRVLQTVDTQN
Download sequence
Identical sequences K9QE01
gi|427708371|ref|YP_007050748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]