SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9QVV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9QVV2
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.1e-57
Family Methylesterase CheB, C-terminal domain 0.0000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9QVV2
Sequence length 190
Comment (tr|K9QVV2|K9QVV2_NOSS7) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=28072 OS=Nostoc sp. (strain ATCC 29411 / PCC 7524). GN=Nos7524_3104 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MSFKIVVIGTSLGGLWALQKILGNLPADFLVPMAIVQHRHKDSDDTLIALLQEYSALPIQ
EVEDKEEILPGQVYIAPADYHLLVEPGHFALSTDQPVSYARPSIDVLFESAADVYGQQVI
GLILTGANQDGKQGLKAVKARGGITIVQEPTTAESAIMPTAAISAVAVDWVVSVLEISPL
LVKLCHSIEN
Download sequence
Identical sequences K9QVV2
WP_015139342.1.5551 gi|427730267|ref|YP_007076504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]