SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9R902 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9R902
Domain Number 1 Region: 70-208
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.9e-41
Family Pentapeptide repeats 0.00035
Further Details:      
 
Domain Number 2 Region: 15-69
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000000381
Family Pentapeptide repeats 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9R902
Sequence length 213
Comment (tr|K9R902|K9R902_9CYAN) Putative low-complexity protein {ECO:0000313|EMBL:AFY53921.1} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_1356 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MSIEAIKSGELKQLAGANLEDENLSQTDLSRANLAGANLVGTNFAGSKFEGAHLEGANLM
GANLKETDLRANLMGANLMQADLTGADVRGSNLRGANLMGAVISEVSFAGAFLSGTNLIN
VDLQGVDLRGADLRGANLTGANLKGADLSRADLQGALLSEANLEEADLRKANLSGANLAG
ANLLCAELEGANVNGVDFDRACLVGTIAHKLPK
Download sequence
Identical sequences K9R902
WP_015117498.1.44015 gi|427734924|ref|YP_007054468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]