SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RAY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RAY8
Domain Number 1 Region: 5-238
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.34e-77
Family SAICAR synthase 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9RAY8
Sequence length 245
Comment (tr|K9RAY8|K9RAY8_9CYAN) SAICAR synthetase {ECO:0000256|HAMAP-Rule:MF_00137} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_2613 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MSVNSKLYEGKAKILYQTDVPEILLADFKDDATAFNAQKRGTISNKGTINCSISSKLFQK
LEQNGINTHYLDNPTSNQMRVKAVRIIPLEVVVRNIAAGSLCKQTGLELGTLLKKPLVEF
YYKNDELGDPLLTKERLLLLELASEEQVEEIIHLTLRINEFLKDFFGKCDITLVDFKLEF
GVDSQQRLLLADEISPDTCRLWDNSTNDSKDRVLDKDRFRKDLGNVENAYQEVLERVLKT
VEANI
Download sequence
Identical sequences K9RAY8
gi|427736123|ref|YP_007055667.1| WP_015118693.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]